SCOPe 2.04: Domain d2q86b2: 2q86 B:112-235

Lineage for d2q86b2 (2q86 B:112-235)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d2q86b2: 2q86 B:112-235 [150121]
   Other proteins in same PDB: d2q86a1, d2q86a2, d2q86b1, d2q86c1, d2q86c2, d2q86d1
   automated match to d1tcrb2
   complexed with nag

Details for d2q86b2

PDB Entry: 2q86, 1.85 Å

PDB Description: structure of the mouse invariant nkt cell receptor valpha14

PDB Compounds: (B:) Vbeta8.2

SCOPe Domain Sequences for d2q86b2:

Sequence; same for both SEQRES and ATOM records:

>d2q86b2 b.1.1.2 (B:112-235) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

Timeline for d2q86b2:

• d2q86b2 first appeared in SCOP 1.75
  
• d2q86b2 appears in SCOPe 2.03
  
• d2q86b2 appears in SCOPe 2.05
  
• d2q86b2 appears in the current release, SCOPe 2.08