SCOP 1.67: Domain d1flp__: 1flp -

Lineage for d1flp__ (1flp -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries)

8. Domain d1flp__: 1flp - [15011]
   complexed with hem

Details for d1flp__

PDB Entry: 1flp, 1.5 Å

PDB Description: structure of the sulfide-reactive hemoglobin from the clam lucina pectinata: crystallographic analysis at 1.5 angstroms resolution

SCOP Domain Sequences for d1flp__:

Sequence; same for both SEQRES and ATOM records:

>d1flp__ a.1.1.2 (-) Hemoglobin I {Clam (Lucina pectinata)}
sleaaqksnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
ggdegawtavagalmgeiepdm

Timeline for d1flp__:

• d1flp__ first appeared (with stable ids) in SCOP 1.55
  
• d1flp__ appears in SCOP 1.65
  
• d1flp__ appears in SCOP 1.69
  
• d1flp__ appears in the current release, SCOPe 2.08, called d1flpa_