Lineage for d2q7ya1 (2q7y A:186-279)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106653Protein CD1, alpha-3 domain [88615] (4 species)
  7. 1106669Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries)
  8. 1106673Domain d2q7ya1: 2q7y A:186-279 [150106]
    Other proteins in same PDB: d2q7ya2, d2q7yb_, d2q7yc2, d2q7yd_
    automatically matched to d1cd1a1
    complexed with igc, nag, plm

Details for d2q7ya1

PDB Entry: 2q7y (more details), 1.95 Å

PDB Description: structure of the endogenous inkt cell ligand igb3 bound to mcd1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2q7ya1:

Sequence, based on SEQRES records: (download)

>d2q7ya1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d2q7ya1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d2q7ya1:

Click to download the PDB-style file with coordinates for d2q7ya1.
(The format of our PDB-style files is described here.)

Timeline for d2q7ya1: