Lineage for d2q7wa1 (2q7w A:1-396)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840451Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 840509Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 840544Species Escherichia coli [TaxId:562] [53390] (62 PDB entries)
    Uniprot P00509
  8. 840545Domain d2q7wa1: 2q7w A:1-396 [150105]
    automatically matched to d1aawa_
    complexed with gol, kst, pmp, psz, so4

Details for d2q7wa1

PDB Entry: 2q7w (more details), 1.4 Å

PDB Description: Structural Studies Reveals the Inactivation of E. coli L-aspartate aminotransferase (S)-4,5-amino-dihydro-2-thiophenecarboxylic acid (SADTA) via two mechanisms at pH 6.0
PDB Compounds: (A:) aspartate aminotransferase

SCOP Domain Sequences for d2q7wa1:

Sequence, based on SEQRES records: (download)

>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

Sequence, based on observed residues (ATOM records): (download)

>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapakinlgigvykdetgktpvltsvkkaeqyllenettknylgidgipefgrc
tqellfgkgsalindkrartaqtpggtgalrvaadflakntsvkrvwvsnpswpnhksvf
nsaglevreyayydaenhtldfdalinslneaqagdvvlfhgcchnptgidptleqwqtl
aqlsvekgwlplfdfayqgfargleedaeglrafaamhkelivassysknfglynervga
ctlvaadsetvdrafsqmkaairanysnppahgasvvatilsndalraiweqeltdmrqr
iqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlrlreefgvyavasgrvnv
agmtpdnmaplceaivavl

SCOP Domain Coordinates for d2q7wa1:

Click to download the PDB-style file with coordinates for d2q7wa1.
(The format of our PDB-style files is described here.)

Timeline for d2q7wa1: