Lineage for d2q7rf1 (2q7r F:1-139)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888555Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 888556Superfamily f.56.1: MAPEG domain-like [161084] (1 family) (S)
  5. 888557Family f.56.1.1: MAPEG domain [161085] (3 proteins)
    Pfam PF01124
  6. 888558Protein Arachidonate 5-lipoxygenase-activating protein, FLAP [161086] (1 species)
  7. 888559Species Human (Homo sapiens) [TaxId:9606] [161087] (2 PDB entries)
    Uniprot P20292 1-139
  8. 888565Domain d2q7rf1: 2q7r F:1-139 [150102]
    automatically matched to 2Q7M A:1-139
    complexed with 3cs; mutant

Details for d2q7rf1

PDB Entry: 2q7r (more details), 4 Å

PDB Description: crystal structure of human flap with an iodinated analog of mk-591
PDB Compounds: (F:) Arachidonate 5-lipoxygenase-activating protein

SCOP Domain Sequences for d2q7rf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7rf1 f.56.1.1 (F:1-139) Arachidonate 5-lipoxygenase-activating protein, FLAP {Human (Homo sapiens) [TaxId: 9606]}
mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
flflmsvagifnyylifff

SCOP Domain Coordinates for d2q7rf1:

Click to download the PDB-style file with coordinates for d2q7rf1.
(The format of our PDB-style files is described here.)

Timeline for d2q7rf1: