Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.56: MAPEG domain-like [161083] (1 superfamily) 4 helices, bundle; left-handed superhelix |
Superfamily f.56.1: MAPEG domain-like [161084] (1 family) |
Family f.56.1.1: MAPEG domain [161085] (3 proteins) Pfam PF01124 |
Protein Arachidonate 5-lipoxygenase-activating protein, FLAP [161086] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [161087] (2 PDB entries) Uniprot P20292 1-139 |
Domain d2q7rd1: 2q7r D:1-139 [150100] automatically matched to 2Q7M A:1-139 complexed with 3cs; mutant |
PDB Entry: 2q7r (more details), 4 Å
SCOP Domain Sequences for d2q7rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7rd1 f.56.1.1 (D:1-139) Arachidonate 5-lipoxygenase-activating protein, FLAP {Human (Homo sapiens) [TaxId: 9606]} mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil flflmsvagifnyylifff
Timeline for d2q7rd1: