Lineage for d1b0b__ (1b0b -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin I [46464] (2 species) Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries) 
Domain d1b0b__: 1b0b - [15010]
Details for d1b0b__
PDB Entry: 1b0b (more details), 1.43 Å
PDB Description: hemoglobin i from the clam lucina pectinata, cyanide complex at 100 kelvin
SCOP Domain Sequences for d1b0b__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0b__ a.1.1.2 (-) Hemoglobin I {Clam (Lucina pectinata)}
slsaaqkdnvksswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlagfmksy
ggdegawtavagalmgmirpdm
SCOP Domain Coordinates for d1b0b__:
Click to download the PDB-style file with coordinates for d1b0b__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0b__:
- d1b0b__ appears in SCOP 1.57
- d1b0b__ appears in the current release, SCOPe 2.08, called d1b0ba_
View in 3D