SCOP 1.75: Domain d2q7oe1: 2q7o E:1-284

Lineage for d2q7oe1 (2q7o E:1-284)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53170] (17 PDB entries)
   Uniprot P00491

8. Domain d2q7oe1: 2q7o E:1-284 [150096]
   automatically matched to d1ulaa_
   complexed with imh, po4

Details for d2q7oe1

PDB Entry: 2q7o, 2.9 Å

PDB Description: structure of human purine nucleoside phosphorylase in complex with l- immucillin-h

PDB Compounds: (E:) purine nucleoside phosphorylase

SCOP Domain Sequences for d2q7oe1:

Sequence; same for both SEQRES and ATOM records:

>d2q7oe1 c.56.2.1 (E:1-284) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasipl

Timeline for d2q7oe1:

• d2q7oe1 is new in SCOP 1.75
  
• d2q7oe1 is called d2q7oe_ in SCOPe 2.01
  
• d2q7oe1 appears in the current release, SCOPe 2.08, called d2q7oe_