Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Leukemia inhibitory factor (LIF) [47274] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [63529] (3 PDB entries) |
Domain d2q7nd1: 2q7n D:12-180 [150095] automatically matched to d1pvhb_ complexed with nag |
PDB Entry: 2q7n (more details), 4 Å
SCOPe Domain Sequences for d2q7nd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7nd1 a.26.1.1 (D:12-180) Leukemia inhibitory factor (LIF) {Human (Homo sapiens) [TaxId: 9606]} cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf
Timeline for d2q7nd1: