SCOPe 2.07: Domain d2q7ma1: 2q7m A:1-139

Lineage for d2q7ma1 (2q7m A:1-139)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.56: MAPEG domain-like [161083] (1 superfamily)
   4 helices, bundle; left-handed superhelix

4. Superfamily f.56.1: MAPEG domain-like [161084] (2 families)

5. Family f.56.1.1: MAPEG domain [161085] (3 proteins)
   Pfam PF01124

6. Protein Arachidonate 5-lipoxygenase-activating protein, FLAP [161086] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161087] (2 PDB entries)
   Uniprot P20292 1-139

8. Domain d2q7ma1: 2q7m A:1-139 [150088]
   complexed with 2cs

Details for d2q7ma1

PDB Entry: 2q7m, 4.25 Å

PDB Description: crystal structure of human flap with mk-591

PDB Compounds: (A:) Arachidonate 5-lipoxygenase-activating protein

SCOPe Domain Sequences for d2q7ma1:

Sequence; same for both SEQRES and ATOM records:

>d2q7ma1 f.56.1.1 (A:1-139) Arachidonate 5-lipoxygenase-activating protein, FLAP {Human (Homo sapiens) [TaxId: 9606]}
mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
flflmsvagifnyylifff

Timeline for d2q7ma1:

• d2q7ma1 first appeared in SCOP 1.75
  
• d2q7ma1 appears in SCOPe 2.06
  
• d2q7ma1 appears in the current release, SCOPe 2.08