Lineage for d2q7ma1 (2q7m A:1-139)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028966Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 3028967Superfamily f.56.1: MAPEG domain-like [161084] (2 families) (S)
  5. 3028968Family f.56.1.1: MAPEG domain [161085] (3 proteins)
    Pfam PF01124
  6. 3028969Protein Arachidonate 5-lipoxygenase-activating protein, FLAP [161086] (1 species)
  7. 3028970Species Human (Homo sapiens) [TaxId:9606] [161087] (2 PDB entries)
    Uniprot P20292 1-139
  8. 3028977Domain d2q7ma1: 2q7m A:1-139 [150088]
    complexed with 2cs

Details for d2q7ma1

PDB Entry: 2q7m (more details), 4.25 Å

PDB Description: crystal structure of human flap with mk-591
PDB Compounds: (A:) Arachidonate 5-lipoxygenase-activating protein

SCOPe Domain Sequences for d2q7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7ma1 f.56.1.1 (A:1-139) Arachidonate 5-lipoxygenase-activating protein, FLAP {Human (Homo sapiens) [TaxId: 9606]}
mdqetvgnvvllaivtlisvvqngffahkvehesrtqngrsfqrtgtlafervytanqnc
vdayptflavlwsagllcsqvpaafaglmylfvrqkyfvgylgertqstpgyifgkriil
flflmsvagifnyylifff

SCOPe Domain Coordinates for d2q7ma1:

Click to download the PDB-style file with coordinates for d2q7ma1.
(The format of our PDB-style files is described here.)

Timeline for d2q7ma1: