![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein automated matches [190103] (4 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [161323] (1 PDB entry) |
![]() | Domain d2q7fa1: 2q7f A:127-191 [150085] automatically matched to d2avpa1 |
PDB Entry: 2q7f (more details), 2.49 Å
SCOPe Domain Sequences for d2q7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7fa1 a.118.8.1 (A:127-191) automated matches {Bacillus subtilis [TaxId: 1423]} dlfymlgtvlvkleqpklalpylqravelnendtearfqfgmclanegmldealsqfaav teqdp
Timeline for d2q7fa1: