Lineage for d2q7fa1 (2q7f A:127-191)

  1. Root: SCOPe 2.01
  2. 1074148Class k: Designed proteins [58788] (44 folds)
  3. 1074796Fold k.38: TPR domain-based design [90307] (1 superfamily)
  4. 1074797Superfamily k.38.1: TPR domain-based design [90308] (1 family) (S)
  5. 1074798Family k.38.1.1: TPR domain-based design [90309] (3 proteins)
    alpha-helical arrays from an idealized TPR motif
  6. 1074799Protein An 8 repeat consensus TPR superhelix [144342] (3 species)
  7. 1074800Species Bacillus subtilis [TaxId:1423] [161323] (1 PDB entry)
  8. 1074801Domain d2q7fa1: 2q7f A:127-191 [150085]
    automatically matched to d2avpa1

Details for d2q7fa1

PDB Entry: 2q7f (more details), 2.49 Å

PDB Description: Crystal structure of YrrB: a TPR protein with an unusual peptide-binding site
PDB Compounds: (A:) YrrB protein

SCOPe Domain Sequences for d2q7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7fa1 k.38.1.1 (A:127-191) An 8 repeat consensus TPR superhelix {Bacillus subtilis [TaxId: 1423]}
dlfymlgtvlvkleqpklalpylqravelnendtearfqfgmclanegmldealsqfaav
teqdp

SCOPe Domain Coordinates for d2q7fa1:

Click to download the PDB-style file with coordinates for d2q7fa1.
(The format of our PDB-style files is described here.)

Timeline for d2q7fa1: