![]() | Class k: Designed proteins [58788] (44 folds) |
![]() | Fold k.38: TPR domain-based design [90307] (1 superfamily) |
![]() | Superfamily k.38.1: TPR domain-based design [90308] (1 family) ![]() |
![]() | Family k.38.1.1: TPR domain-based design [90309] (3 proteins) alpha-helical arrays from an idealized TPR motif |
![]() | Protein An 8 repeat consensus TPR superhelix [144342] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [161323] (1 PDB entry) |
![]() | Domain d2q7fa1: 2q7f A:127-191 [150085] automatically matched to d2avpa1 |
PDB Entry: 2q7f (more details), 2.49 Å
SCOP Domain Sequences for d2q7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7fa1 k.38.1.1 (A:127-191) An 8 repeat consensus TPR superhelix {Bacillus subtilis [TaxId: 1423]} dlfymlgtvlvkleqpklalpylqravelnendtearfqfgmclanegmldealsqfaav teqdp
Timeline for d2q7fa1: