Lineage for d2q7fa1 (2q7f A:127-191)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726794Protein automated matches [190103] (5 species)
    not a true protein
  7. 2726795Species Bacillus subtilis [TaxId:1423] [161323] (1 PDB entry)
  8. 2726796Domain d2q7fa1: 2q7f A:127-191 [150085]
    automatically matched to d2avpa1

Details for d2q7fa1

PDB Entry: 2q7f (more details), 2.49 Å

PDB Description: Crystal structure of YrrB: a TPR protein with an unusual peptide-binding site
PDB Compounds: (A:) YrrB protein

SCOPe Domain Sequences for d2q7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7fa1 a.118.8.1 (A:127-191) automated matches {Bacillus subtilis [TaxId: 1423]}
dlfymlgtvlvkleqpklalpylqravelnendtearfqfgmclanegmldealsqfaav
teqdp

SCOPe Domain Coordinates for d2q7fa1:

Click to download the PDB-style file with coordinates for d2q7fa1.
(The format of our PDB-style files is described here.)

Timeline for d2q7fa1: