SCOPe 2.06: Domain d2q78f2: 2q78 F:1-133

Lineage for d2q78f2 (2q78 F:1-133)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
   contains extra C-terminal helix

6. Protein Uncharacterized protein TM0581 [160186] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [160187] (1 PDB entry)
   Uniprot Q9WZ50 1-130

8. Domain d2q78f2: 2q78 F:1-133 [150081]
   Other proteins in same PDB: d2q78a2, d2q78b3, d2q78c3, d2q78e3, d2q78f3, d2q78g3, d2q78h3
   automated match to d2q78a1
   complexed with cl, mlc

Details for d2q78f2

PDB Entry: 2q78, 2.2 Å

PDB Description: crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d2q78f2:

Sequence; same for both SEQRES and ATOM records:

>d2q78f2 d.38.1.7 (F:1-133) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]}
mmdfdflegkrltedvaldetmvwnediemldlhlvatsaligvvhrvsyellsrylpnd
ytavvvetlarhvkavptgtrvavgvrvvgvvgnrvkfrgivmsgdekileaefvraivp
reklrrlalekae

Timeline for d2q78f2:

• d2q78f2 first appeared in SCOP 1.75, called d2q78f1
  
• d2q78f2 was called d2q78f_ in SCOPe 2.05
  
• d2q78f2 appears in SCOPe 2.07
  
• d2q78f2 appears in the current release, SCOPe 2.08