Lineage for d1sctg_ (1sct G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075134Protein Hemoglobin I [46464] (2 species)
  7. 1075135Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (37 PDB entries)
  8. 1075206Domain d1sctg_: 1sct G: [15008]
    complexed with cmo, hem

Details for d1sctg_

PDB Entry: 1sct (more details), 2 Å

PDB Description: scapharca tetrameric hemoglobin, co-state
PDB Compounds: (G:) hemoglobin II (carbonmonoxy) (alpha chain)

SCOPe Domain Sequences for d1sctg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sctg_ a.1.1.2 (G:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
tlkarmgnyysddvagawaalvgvvqaal

SCOPe Domain Coordinates for d1sctg_:

Click to download the PDB-style file with coordinates for d1sctg_.
(The format of our PDB-style files is described here.)

Timeline for d1sctg_: