Lineage for d1sctg_ (1sct G:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530605Protein Hemoglobin I [46464] (2 species)
  7. 530606Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries)
  8. 530641Domain d1sctg_: 1sct G: [15008]

Details for d1sctg_

PDB Entry: 1sct (more details), 2 Å

PDB Description: scapharca tetrameric hemoglobin, co-state

SCOP Domain Sequences for d1sctg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sctg_ a.1.1.2 (G:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
vdaavakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkg
kansklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmke
tlkarmgnyysddvagawaalvgvvqaal

SCOP Domain Coordinates for d1sctg_:

Click to download the PDB-style file with coordinates for d1sctg_.
(The format of our PDB-style files is described here.)

Timeline for d1sctg_: