Lineage for d2q78b1 (2q78 B:1-130)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858980Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
    contains extra C-terminal helix
  6. 858987Protein Uncharacterized protein TM0581 [160186] (1 species)
  7. 858988Species Thermotoga maritima [TaxId:2336] [160187] (1 PDB entry)
    Uniprot Q9WZ50 1-130
  8. 858990Domain d2q78b1: 2q78 B:1-130 [150077]
    automatically matched to 2Q78 A:1-130
    complexed with cl, mlc

Details for d2q78b1

PDB Entry: 2q78 (more details), 2.2 Å

PDB Description: crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution
PDB Compounds: (B:) Uncharacterized protein

SCOP Domain Sequences for d2q78b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q78b1 d.38.1.7 (B:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]}
mmdfdflegkrltedvaldetmvwnediemldlhlvatsaligvvhrvsyellsrylpnd
ytavvvetlarhvkavptgtrvavgvrvvgvvgnrvkfrgivmsgdekileaefvraivp
reklrrlale

SCOP Domain Coordinates for d2q78b1:

Click to download the PDB-style file with coordinates for d2q78b1.
(The format of our PDB-style files is described here.)

Timeline for d2q78b1: