Lineage for d2q6ng1 (2q6n G:28-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005352Protein Mammalian cytochrome p450 2b4 [101375] (1 species)
  7. 2005353Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [101376] (10 PDB entries)
    Uniprot P00178
  8. 2005373Domain d2q6ng1: 2q6n G:28-491 [150067]
    Other proteins in same PDB: d2q6na2, d2q6nb2, d2q6nc2, d2q6nd2, d2q6ne2, d2q6nf2, d2q6ng2
    automatically matched to d1suoa_
    complexed with 1ci, hem

Details for d2q6ng1

PDB Entry: 2q6n (more details), 3.2 Å

PDB Description: Structure of Cytochrome P450 2B4 with Bound 1-(4-cholorophenyl)imidazole
PDB Compounds: (G:) Cytochrome P450 2B4

SCOPe Domain Sequences for d2q6ng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q6ng1 a.104.1.1 (G:28-491) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
lissfssqvfelfsgflkyfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
lffttilqnfsiaspvppedidltpresgvgnvppsyqirflar

SCOPe Domain Coordinates for d2q6ng1:

Click to download the PDB-style file with coordinates for d2q6ng1.
(The format of our PDB-style files is described here.)

Timeline for d2q6ng1: