| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) ![]() |
| Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543 |
| Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries) |
| Domain d2q66a2: 2q66 A:5-201 [150058] Other proteins in same PDB: d2q66a1, d2q66a3 automatically matched to d1fa0b4 protein/RNA complex; complexed with atp, edo, mg |
PDB Entry: 2q66 (more details), 1.8 Å
SCOPe Domain Sequences for d2q66a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q66a2 d.218.1.3 (A:5-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfvy
evskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsll
rerkeldeiapvpdafvpiikikfsgisialicarldqpqvplsltlsdknllrnldekd
lralngtrvtdeilelv
Timeline for d2q66a2: