SCOPe 2.07: Domain d2q66a1: 2q66 A:202-351

Lineage for d2q66a1 (2q66 A:202-351)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)

6. Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries)

8. Domain d2q66a1: 2q66 A:202-351 [150057]
   Other proteins in same PDB: d2q66a2, d2q66a3
   automatically matched to d1fa0a3
   protein/RNA complex; complexed with atp, edo, mg

Details for d2q66a1

PDB Entry: 2q66, 1.8 Å

PDB Description: structure of yeast poly(a) polymerase with atp and oligo(a)

PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2q66a1:

Sequence; same for both SEQRES and ATOM records:

>d2q66a1 a.160.1.1 (A:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi
ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk
kvilqefvrgvqitndifsnkkswanlfek

Timeline for d2q66a1:

• d2q66a1 first appeared in SCOP 1.75
  
• d2q66a1 appears in SCOPe 2.06
  
• d2q66a1 appears in the current release, SCOPe 2.08