Lineage for d2q5sb_ (2q5s B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (111 PDB entries)
    Uniprot P37231 232-505
  8. 2008977Domain d2q5sb_: 2q5s B: [150054]
    automated match to d1wm0x_
    complexed with nza

Details for d2q5sb_

PDB Entry: 2q5s (more details), 2.05 Å

PDB Description: crystal structure of ppargamma bound to partial agonist ntzdpa
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2q5sb_:

Sequence, based on SEQRES records: (download)

>d2q5sb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d2q5sb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkikfkhkev
airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
ktetdmlhpllqeiykdl

SCOPe Domain Coordinates for d2q5sb_:

Click to download the PDB-style file with coordinates for d2q5sb_.
(The format of our PDB-style files is described here.)

Timeline for d2q5sb_: