SCOPe 2.06: Domain d2q5bc_: 2q5b C:

Lineage for d2q5bc_ (2q5b C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Phormidium laminosum [TaxId:32059] [49518] (8 PDB entries)

8. Domain d2q5bc_: 2q5b C: [150047]
   automated match to d1bawa_
   complexed with act, cu, k, zn

Details for d2q5bc_

PDB Entry: 2q5b, 1.45 Å

PDB Description: High resolution structure of Plastocyanin from Phormidium laminosum

PDB Compounds: (C:) plastocyanin

SCOPe Domain Sequences for d2q5bc_:

Sequence; same for both SEQRES and ATOM records:

>d2q5bc_ b.6.1.1 (C:) Plastocyanin {Phormidium laminosum [TaxId: 32059]}
etftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

Timeline for d2q5bc_:

• d2q5bc_ first appeared in SCOP 1.75, called d2q5bc1
  
• d2q5bc_ appears in SCOPe 2.05
  
• d2q5bc_ appears in SCOPe 2.07
  
• d2q5bc_ appears in the current release, SCOPe 2.08