SCOP 1.75: Domain d2q5bc1: 2q5b C:1-105

Lineage for d2q5bc1 (2q5b C:1-105)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Cyanobacterium (Phormidium laminosum) [TaxId:32059] [49518] (2 PDB entries)

8. Domain d2q5bc1: 2q5b C:1-105 [150047]
   automatically matched to d1bawa_
   complexed with act, cu, k, zn

Details for d2q5bc1

PDB Entry: 2q5b, 1.45 Å

PDB Description: High resolution structure of Plastocyanin from Phormidium laminosum

PDB Compounds: (C:) plastocyanin

SCOP Domain Sequences for d2q5bc1:

Sequence; same for both SEQRES and ATOM records:

>d2q5bc1 b.6.1.1 (C:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]}
etftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

Timeline for d2q5bc1:

• d2q5bc1 is new in SCOP 1.75
  
• d2q5bc1 is called d2q5bc_ in SCOPe 2.01
  
• d2q5bc1 appears in the current release, SCOPe 2.08, called d2q5bc_