Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Plastocyanin [49507] (17 species) |
Species Phormidium laminosum [TaxId:32059] [49518] (8 PDB entries) |
Domain d2q5ba_: 2q5b A: [150045] automated match to d1bawa_ complexed with act, cu, k, zn |
PDB Entry: 2q5b (more details), 1.45 Å
SCOPe Domain Sequences for d2q5ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q5ba_ b.6.1.1 (A:) Plastocyanin {Phormidium laminosum [TaxId: 32059]} etftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg
Timeline for d2q5ba_: