SCOPe 2.08: Domain d2q4pb_: 2q4p B:

Lineage for d2q4pb_ (2q4p B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (4 proteins)
   Pfam PF03819

6. Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
   confirmed prediction of the m5dCTPase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
   Uniprot Q9QY93 22-134

8. Domain d2q4pb_: 2q4p B: [150042]
   automated match to d2a3qa1

Details for d2q4pb_

PDB Entry: 2q4p, 2.32 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Mus musculus Mm.29898

PDB Compounds: (B:) Protein RS21-C6

SCOPe Domain Sequences for d2q4pb_:

Sequence; same for both SEQRES and ATOM records:

>d2q4pb_ a.204.1.2 (B:) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp
qawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqryp

Timeline for d2q4pb_:

• d2q4pb_ first appeared in SCOP 1.75, called d2q4pb1
  
• d2q4pb_ appears in SCOPe 2.07