Class a: All alpha proteins [46456] (290 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.2: MazG-like [116993] (4 proteins) Pfam PF03819 |
Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species) confirmed prediction of the m5dCTPase activity |
Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries) Uniprot Q9QY93 22-134 |
Domain d2q4pb_: 2q4p B: [150042] automated match to d2a3qa1 |
PDB Entry: 2q4p (more details), 2.32 Å
SCOPe Domain Sequences for d2q4pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q4pb_ a.204.1.2 (B:) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]} pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp qawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqryp
Timeline for d2q4pb_: