SCOP 1.75: Domain d2q4pa1: 2q4p A:22-134

Lineage for d2q4pa1 (2q4p A:22-134)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (3 proteins)
   Pfam PF03819

6. Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
   confirmed prediction of the m5dCTPase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
   Uniprot Q9QY93 22-134

8. Domain d2q4pa1: 2q4p A:22-134 [150041]
   automatically matched to 2A3Q A:22-134

Details for d2q4pa1

PDB Entry: 2q4p, 2.32 Å

PDB Description: Ensemble refinement of the crystal structure of protein from Mus musculus Mm.29898

PDB Compounds: (A:) Protein RS21-C6

SCOP Domain Sequences for d2q4pa1:

Sequence; same for both SEQRES and ATOM records:

>d2q4pa1 a.204.1.2 (A:22-134) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp
qawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqrypvhls

Timeline for d2q4pa1:

• d2q4pa1 is new in SCOP 1.75
  
• d2q4pa1 appears in SCOPe 2.01
  
• d2q4pa1 appears in the current release, SCOPe 2.08, called d2q4pa_