Lineage for d2q3za1 (2q3z A:15-145)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039168Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2039169Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2039207Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (4 PDB entries)
    GDP-binding protein
  8. 2039208Domain d2q3za1: 2q3z A:15-145 [150037]
    Other proteins in same PDB: d2q3za2, d2q3za3, d2q3za4
    automatically matched to d1kv3a1
    complexed with so4

Details for d2q3za1

PDB Entry: 2q3z (more details), 2 Å

PDB Description: transglutaminase 2 undergoes large conformational change upon activation
PDB Compounds: (A:) Transglutaminase 2

SCOPe Domain Sequences for d2q3za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3za1 b.1.18.9 (A:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk
arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh
fillfnawcpa

SCOPe Domain Coordinates for d2q3za1:

Click to download the PDB-style file with coordinates for d2q3za1.
(The format of our PDB-style files is described here.)

Timeline for d2q3za1: