Lineage for d2q3nb2 (2q3n B:7-140)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 800938Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 800939Family b.42.2.1: Ricin B-like [50371] (10 proteins)
  6. 800949Protein Agglutinin-1 chain B [159150] (1 species)
  7. 800950Species Abrus precatorius [TaxId:3816] [159151] (1 PDB entry)
    Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547
  8. 800952Domain d2q3nb2: 2q3n B:7-140 [150036]
    Other proteins in same PDB: d2q3na1
    complexed with nag

Details for d2q3nb2

PDB Entry: 2q3n (more details), 3.5 Å

PDB Description: agglutinin from abrus precatorius (apa-i)
PDB Compounds: (B:) Agglutinin-1 B chain

SCOP Domain Sequences for d2q3nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3nb2 b.42.2.1 (B:7-140) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
icsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdktirskg
kclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmggtltvq
kndyrmrqgwrtgn

SCOP Domain Coordinates for d2q3nb2:

Click to download the PDB-style file with coordinates for d2q3nb2.
(The format of our PDB-style files is described here.)

Timeline for d2q3nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q3nb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2q3na1