![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (10 proteins) |
![]() | Protein Agglutinin-1 chain B [159150] (1 species) |
![]() | Species Abrus precatorius [TaxId:3816] [159151] (1 PDB entry) Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547 |
![]() | Domain d2q3nb2: 2q3n B:7-140 [150036] Other proteins in same PDB: d2q3na1 complexed with nag |
PDB Entry: 2q3n (more details), 3.5 Å
SCOP Domain Sequences for d2q3nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3nb2 b.42.2.1 (B:7-140) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]} icsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdktirskg kclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmggtltvq kndyrmrqgwrtgn
Timeline for d2q3nb2: