SCOPe 2.02: Domain d2q3nb1: 2q3n B:141-267

Lineage for d2q3nb1 (2q3n B:141-267)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (3 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Agglutinin-1 chain B [159150] (1 species)

7. Species Abrus precatorius [TaxId:3816] [159151] (1 PDB entry)
   Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547

8. Domain d2q3nb1: 2q3n B:141-267 [150035]
   Other proteins in same PDB: d2q3na1
   complexed with nag

Details for d2q3nb1

PDB Entry: 2q3n, 3.5 Å

PDB Description: agglutinin from abrus precatorius (apa-i)

PDB Compounds: (B:) Agglutinin-1 B chain

SCOPe Domain Sequences for d2q3nb1:

Sequence; same for both SEQRES and ATOM records:

>d2q3nb1 b.42.2.1 (B:141-267) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
dtspfvtsiagffklcmeahgnsmwldvcditkeeqqwavypdgsirpvqntnncltcee
hkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdvkssdpslkqiilwpytgnan
qmwatlf

Timeline for d2q3nb1:

• d2q3nb1 first appeared in SCOP 1.75
  
• d2q3nb1 appears in SCOPe 2.01
  
• d2q3nb1 appears in SCOPe 2.03
  
• d2q3nb1 appears in the current release, SCOPe 2.08