| Class b: All beta proteins [48724] (180 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein Agglutinin-1 chain B [159150] (1 species) |
| Species Abrus precatorius [TaxId:3816] [159151] (2 PDB entries) Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547 |
| Domain d2q3nb1: 2q3n B:141-267 [150035] Other proteins in same PDB: d2q3na1 complexed with nag |
PDB Entry: 2q3n (more details), 3.5 Å
SCOPe Domain Sequences for d2q3nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3nb1 b.42.2.1 (B:141-267) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
dtspfvtsiagffklcmeahgnsmwldvcditkeeqqwavypdgsirpvqntnncltcee
hkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdvkssdpslkqiilwpytgnan
qmwatlf
Timeline for d2q3nb1: