![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Agglutinin-1 chain A [160917] (1 species) |
![]() | Species Abrus precatorius [TaxId:3816] [160918] (1 PDB entry) Uniprot Q9M6E9 22-268 |
![]() | Domain d2q3na1: 2q3n A:2-248 [150034] Other proteins in same PDB: d2q3nb1, d2q3nb2 complexed with nag |
PDB Entry: 2q3n (more details), 3.5 Å
SCOPe Domain Sequences for d2q3na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3na1 d.165.1.1 (A:2-248) Agglutinin-1 chain A {Abrus precatorius [TaxId: 3816]} dpikfttgsatpasynqfidalrerltggliygipvlrdpstvekpnqyvtvelsysdtv siqlgidltnayvvayragsesfffrnapasastylftgtqqyslpfdgnyddlekwahq srqrislglealrqgikflrsgasddeeiartliviiqmvaeaarfryvsklvvislsnr aafqpdpsmlslentweplsravqhtvqdtfpqnvtlinvrqervvvsslshpsvsalal mlfvcnp
Timeline for d2q3na1: