Lineage for d2q3la1 (2q3l A:1-125)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852201Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2852253Superfamily c.13.2: SpoIIaa-like [52091] (3 families) (S)
  5. 2852279Family c.13.2.2: Sfri0576-like [159456] (2 proteins)
    significant structural variability despite high sequence similarity
    automatically mapped to Pfam PF11964
  6. 2852284Protein Uncharacterized protein Shew3102 [159457] (1 species)
  7. 2852285Species Shewanella loihica [TaxId:359303] [159458] (1 PDB entry)
    Uniprot A3QHM0 1-125
  8. 2852286Domain d2q3la1: 2q3l A:1-125 [150032]
    Other proteins in same PDB: d2q3la2, d2q3lb3
    complexed with cl, mpd, na

Details for d2q3la1

PDB Entry: 2q3l (more details), 2.25 Å

PDB Description: crystal structure of an uncharacterized protein from duf3478 family with a spoiiaa-like fold (shew_3102) from shewanella loihica pv-4 at 2.25 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2q3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q3la1 c.13.2.2 (A:1-125) Uncharacterized protein Shew3102 {Shewanella loihica [TaxId: 359303]}
mssnlhgiaigiersqddfylafkavgklthedyeqmtpllesalagiktpeivalidit
eldglslhaawddlklglkhgkefkrvaiigqgelqewatrvanwftpgefkffedkrda
ldwlc

SCOPe Domain Coordinates for d2q3la1:

Click to download the PDB-style file with coordinates for d2q3la1.
(The format of our PDB-style files is described here.)

Timeline for d2q3la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q3la2