SCOPe 2.08: Domain d2q3la1: 2q3l A:1-125

Lineage for d2q3la1 (2q3l A:1-125)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (3 families)

5. Family c.13.2.2: Sfri0576-like [159456] (2 proteins)
   significant structural variability despite high sequence similarity
   automatically mapped to Pfam PF11964

6. Protein Uncharacterized protein Shew3102 [159457] (1 species)

7. Species Shewanella loihica [TaxId:359303] [159458] (1 PDB entry)
   Uniprot A3QHM0 1-125

8. Domain d2q3la1: 2q3l A:1-125 [150032]
   Other proteins in same PDB: d2q3la2, d2q3lb3
   complexed with cl, mpd, na

Details for d2q3la1

PDB Entry: 2q3l, 2.25 Å

PDB Description: crystal structure of an uncharacterized protein from duf3478 family with a spoiiaa-like fold (shew_3102) from shewanella loihica pv-4 at 2.25 a resolution

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2q3la1:

Sequence; same for both SEQRES and ATOM records:

>d2q3la1 c.13.2.2 (A:1-125) Uncharacterized protein Shew3102 {Shewanella loihica [TaxId: 359303]}
mssnlhgiaigiersqddfylafkavgklthedyeqmtpllesalagiktpeivalidit
eldglslhaawddlklglkhgkefkrvaiigqgelqewatrvanwftpgefkffedkrda
ldwlc

Timeline for d2q3la1:

• d2q3la1 first appeared in SCOP 1.75
  
• d2q3la1 appears in SCOPe 2.07