Lineage for d2q39b_ (2q39 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072014Protein beta-Lactoglobulin [50827] (4 species)
  7. 2072015Species Cow (Bos taurus) [TaxId:9913] [50828] (56 PDB entries)
    Uniprot P02754
  8. 2072055Domain d2q39b_: 2q39 B: [150031]
    automated match to d1bsoa_

Details for d2q39b_

PDB Entry: 2q39 (more details), 2.5 Å

PDB Description: Beta-lactoglobulin (low humidity)
PDB Compounds: (B:) beta-lactoglobulin

SCOPe Domain Sequences for d2q39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q39b_ b.60.1.1 (B:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
tpevddealekfdkalkalpmhirlsfnptq

SCOPe Domain Coordinates for d2q39b_:

Click to download the PDB-style file with coordinates for d2q39b_.
(The format of our PDB-style files is described here.)

Timeline for d2q39b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2q39a_