SCOP 1.75: Domain d2q39b1: 2q39 B:205-352

Lineage for d2q39b1 (2q39 B:205-352)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
   Uniprot P02754

8. Domain d2q39b1: 2q39 B:205-352 [150031]
   automatically matched to d1bsoa_

Details for d2q39b1

PDB Entry: 2q39, 2.5 Å

PDB Description: Beta-lactoglobulin (low humidity)

PDB Compounds: (B:) beta-lactoglobulin

SCOP Domain Sequences for d2q39b1:

Sequence; same for both SEQRES and ATOM records:

>d2q39b1 b.60.1.1 (B:205-352) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
tpevddealekfdkalkalpmhirlsfn

Timeline for d2q39b1:

• d2q39b1 is new in SCOP 1.75
  
• d2q39b1 is called d2q39b_ in SCOPe 2.01
  
• d2q39b1 appears in the current release, SCOPe 2.08, called d2q39b_