SCOPe 2.07: Domain d2q39a_: 2q39 A:

Lineage for d2q39a_ (2q39 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries)
   Uniprot P02754

8. Domain d2q39a_: 2q39 A: [150030]
   automated match to d1bsoa_

Details for d2q39a_

PDB Entry: 2q39, 2.5 Å

PDB Description: Beta-lactoglobulin (low humidity)

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d2q39a_:

Sequence; same for both SEQRES and ATOM records:

>d2q39a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqc

Timeline for d2q39a_:

• d2q39a_ first appeared in SCOP 1.75, called d2q39a1
  
• d2q39a_ appears in SCOPe 2.06
  
• d2q39a_ appears in the current release, SCOPe 2.08