Lineage for d2q39a1 (2q39 A:1-152)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805892Protein beta-Lactoglobulin [50827] (3 species)
  7. 805893Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
    Uniprot P02754
  8. 805906Domain d2q39a1: 2q39 A:1-152 [150030]
    automatically matched to d1bsoa_

Details for d2q39a1

PDB Entry: 2q39 (more details), 2.5 Å

PDB Description: Beta-lactoglobulin (low humidity)
PDB Compounds: (A:) beta-lactoglobulin

SCOP Domain Sequences for d2q39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q39a1 b.60.1.1 (A:1-152) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfn

SCOP Domain Coordinates for d2q39a1:

Click to download the PDB-style file with coordinates for d2q39a1.
(The format of our PDB-style files is described here.)

Timeline for d2q39a1: