Lineage for d2q37a1 (2q37 A:6-160)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781450Fold a.288: UraD-like [158693] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 781451Superfamily a.288.1: UraD-Like [158694] (1 family) (S)
  5. 781452Family a.288.1.1: UraD-like [158695] (2 proteins)
    Pfam PF09349; OHCU decarboxylase (formerly DUF1991)
  6. 781456Protein OHCU decarboxylase, UraD [158696] (2 species)
    2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
  7. 781457Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [158697] (1 PDB entry)
    Uniprot Q9LVM5 6-160
  8. 781458Domain d2q37a1: 2q37 A:6-160 [150028]
    complexed with 3al

Details for d2q37a1

PDB Entry: 2q37 (more details), 2.5 Å

PDB Description: Crystal structure of OHCU decarboxylase in the presence of (S)-allantoin
PDB Compounds: (A:) OHCU decarboxylase

SCOP Domain Sequences for d2q37a1:

Sequence, based on SEQRES records: (download)

>d2q37a1 a.288.1.1 (A:6-160) OHCU decarboxylase, UraD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gedewkvccgssefakqmstsgpltsqeaiytardiwfnqvnvtdwleafsahpqigntp
spsinsdfarrsvseqstafattsasalqelaewnvlykkkfgfifiicasgrthaemlh
alkeryenrpiveleiaameqmkitelrmaklfsd

Sequence, based on observed residues (ATOM records): (download)

>d2q37a1 a.288.1.1 (A:6-160) OHCU decarboxylase, UraD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gedewkvccgssefakqmstsgpltsqeaiytardiwfnqvnvtdwleafsahpqigntp
seqstafattsasalqelaewnvlykkkfgfifiicasgrthaemlhalkeryenrpive
leiaameqmkitelrmaklfsd

SCOP Domain Coordinates for d2q37a1:

Click to download the PDB-style file with coordinates for d2q37a1.
(The format of our PDB-style files is described here.)

Timeline for d2q37a1: