Lineage for d2q2zb1 (2q2z B:18-362)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364090Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 1364091Protein Kinesin [52646] (7 species)
  7. 1364098Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (13 PDB entries)
  8. 1364127Domain d2q2zb1: 2q2z B:18-362 [150027]
    automatically matched to d1q0bb_
    complexed with adp, mg, mkk

Details for d2q2zb1

PDB Entry: 2q2z (more details), 3 Å

PDB Description: Crystal Structure of KSP in Complex with Inhibitor 22
PDB Compounds: (B:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d2q2zb1:

Sequence, based on SEQRES records: (download)

>d2q2zb1 c.37.1.9 (B:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresklt
rilqdslggrtrtsiiatispaslnleetlstleyahraknilnk

Sequence, based on observed residues (ATOM records): (download)

>d2q2zb1 c.37.1.9 (B:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
iatispaslnleetlstleyahraknilnk

SCOPe Domain Coordinates for d2q2zb1:

Click to download the PDB-style file with coordinates for d2q2zb1.
(The format of our PDB-style files is described here.)

Timeline for d2q2zb1: