![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins) automatically mapped to Pfam PF01068 |
![]() | Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species) |
![]() | Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries) |
![]() | Domain d2q2ud2: 2q2u D:1-189 [150023] Other proteins in same PDB: d2q2ua1, d2q2ub1, d2q2uc1, d2q2ud1 automatically matched to d1p8la2 protein/DNA complex |
PDB Entry: 2q2u (more details), 3 Å
SCOPe Domain Sequences for d2q2ud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q2ud2 d.142.2.1 (D:1-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]} maitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltell pegsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyi tvhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlk egillkmkq
Timeline for d2q2ud2: