Lineage for d2q2ud2 (2q2u D:1-189)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979302Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
    automatically mapped to Pfam PF01068
  6. 2979303Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 2979306Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries)
  8. 2979313Domain d2q2ud2: 2q2u D:1-189 [150023]
    Other proteins in same PDB: d2q2ua1, d2q2ub1, d2q2uc1, d2q2ud1
    automatically matched to d1p8la2
    protein/DNA complex

Details for d2q2ud2

PDB Entry: 2q2u (more details), 3 Å

PDB Description: structure of chlorella virus dna ligase-product dna complex
PDB Compounds: (D:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ud2 d.142.2.1 (D:1-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
maitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltell
pegsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyi
tvhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlk
egillkmkq

SCOPe Domain Coordinates for d2q2ud2:

Click to download the PDB-style file with coordinates for d2q2ud2.
(The format of our PDB-style files is described here.)

Timeline for d2q2ud2: