SCOPe 2.08: Domain d2q2ud1: 2q2u D:190-293

Lineage for d2q2ud1 (2q2u D:190-293)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
Protein ATP-dependent DNA ligase [50310] (2 species)
Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries)

Domain d2q2ud1: 2q2u D:190-293 [150022]
Other proteins in same PDB: d2q2ua2, d2q2ub2, d2q2uc2, d2q2ud2
automatically matched to d1p8la1
protein/DNA complex
has additional insertions and/or extensions that are not grouped together

Details for d2q2ud1

PDB Entry: 2q2u (more details), 3 Å

PDB Description: structure of chlorella virus dna ligase-product dna complex

PDB Compounds: (D:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ud1 b.40.4.6 (D:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

SCOPe Domain Coordinates for d2q2ud1:

Click to download the PDB-style file with coordinates for d2q2ud1.
(The format of our PDB-style files is described here.)

Timeline for d2q2ud1: