SCOPe 2.07: Domain d2q2uc1: 2q2u C:190-293

Lineage for d2q2uc1 (2q2u C:190-293)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)

6. Protein ATP-dependent DNA ligase [50310] (2 species)

7. Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries)

8. Domain d2q2uc1: 2q2u C:190-293 [150020]
   Other proteins in same PDB: d2q2ua2, d2q2ub2, d2q2uc2, d2q2ud2
   automatically matched to d1p8la1
   protein/DNA complex

Details for d2q2uc1

PDB Entry: 2q2u, 3 Å

PDB Description: structure of chlorella virus dna ligase-product dna complex

PDB Compounds: (C:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2uc1:

Sequence; same for both SEQRES and ATOM records:

>d2q2uc1 b.40.4.6 (C:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

Timeline for d2q2uc1:

• d2q2uc1 first appeared in SCOP 1.75
  
• d2q2uc1 appears in SCOPe 2.06
  
• d2q2uc1 appears in the current release, SCOPe 2.08