Lineage for d2q2uc1 (2q2u C:190-293)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399815Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 2399816Protein ATP-dependent DNA ligase [50310] (2 species)
  7. 2399819Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries)
  8. 2399825Domain d2q2uc1: 2q2u C:190-293 [150020]
    Other proteins in same PDB: d2q2ua2, d2q2ub2, d2q2uc2, d2q2ud2
    automatically matched to d1p8la1
    protein/DNA complex

Details for d2q2uc1

PDB Entry: 2q2u (more details), 3 Å

PDB Description: structure of chlorella virus dna ligase-product dna complex
PDB Compounds: (C:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2uc1 b.40.4.6 (C:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

SCOPe Domain Coordinates for d2q2uc1:

Click to download the PDB-style file with coordinates for d2q2uc1.
(The format of our PDB-style files is described here.)

Timeline for d2q2uc1: