Lineage for d2q2ub2 (2q2u B:2-189)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 874173Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 874174Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
  6. 874175Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 874178Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries)
  8. 874182Domain d2q2ub2: 2q2u B:2-189 [150019]
    Other proteins in same PDB: d2q2ua1, d2q2ub1, d2q2uc1, d2q2ud1
    automatically matched to d1p8la2
    complexed with omc

Details for d2q2ub2

PDB Entry: 2q2u (more details), 3 Å

PDB Description: structure of chlorella virus dna ligase-product dna complex
PDB Compounds: (B:) Chlorella virus DNA ligase

SCOP Domain Sequences for d2q2ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ub2 d.142.2.1 (B:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq

SCOP Domain Coordinates for d2q2ub2:

Click to download the PDB-style file with coordinates for d2q2ub2.
(The format of our PDB-style files is described here.)

Timeline for d2q2ub2: