Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) |
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
Protein ATP-dependent DNA ligase [50310] (2 species) |
Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries) |
Domain d2q2ua1: 2q2u A:190-293 [150016] Other proteins in same PDB: d2q2ua2, d2q2ub2, d2q2uc2, d2q2ud2 automatically matched to d1p8la1 complexed with omc |
PDB Entry: 2q2u (more details), 3 Å
SCOP Domain Sequences for d2q2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q2ua1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]} fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir
Timeline for d2q2ua1: