Lineage for d2q22c_ (2q22 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011614Fold d.365: Ava3019-like [160531] (1 superfamily)
    alpha(2)-beta-alpha-beta(4); 2 layers, a/b; antiparallel beta-sheet, order: 32145; similarity to the insert domain of Glucose 6-phosphate dehydrogenase-like family (sop_fa 55376)
  4. 3011615Superfamily d.365.1: Ava3019-like [160532] (1 family) (S)
    automatically mapped to Pfam PF08854
  5. 3011616Family d.365.1.1: Ava3019-like [160533] (1 protein)
    Pfam PF08854; DUF1824
  6. 3011617Protein Uncharacterized protein Ava3019 [160534] (1 species)
  7. 3011618Species Anabaena variabilis [TaxId:1172] [160535] (1 PDB entry)
    Uniprot Q3M8Q7 8-138
  8. 3011621Domain d2q22c_: 2q22 C: [150010]
    automated match to d2q22a1
    complexed with act, cl, edo, pg4

Details for d2q22c_

PDB Entry: 2q22 (more details), 2.11 Å

PDB Description: crystal structure of uncharacterized protein (yp_323524.1) from anabaena variabilis atcc 29413 at 2.11 a resolution
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d2q22c_:

Sequence, based on SEQRES records: (download)

>d2q22c_ d.365.1.1 (C:) Uncharacterized protein Ava3019 {Anabaena variabilis [TaxId: 1172]}
lttadakkilnkfncldiapilkpsekesvrralilitklsdyqilgicadtadegllam
ktyshalgyevpidlpvvegpvyiklngknglcyldsyaghhrgvlvscqsyyegginem
yghlpldlfv

Sequence, based on observed residues (ATOM records): (download)

>d2q22c_ d.365.1.1 (C:) Uncharacterized protein Ava3019 {Anabaena variabilis [TaxId: 1172]}
lttadakkilnkfncldiapilkpsekesvrralilitklsdyqilgicadtadegllam
ktyshalgyevpdlpvvegpvyiklngknglcyldsyaghhrgvlvscqsyyegginemy
ghlpldlfv

SCOPe Domain Coordinates for d2q22c_:

Click to download the PDB-style file with coordinates for d2q22c_.
(The format of our PDB-style files is described here.)

Timeline for d2q22c_: