Lineage for d6hbib_ (6hbi B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299610Protein Hemoglobin I [46464] (2 species)
  7. 2299611Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2299659Domain d6hbib_: 6hbi B: [15001]
    complexed with hem; mutant

Details for d6hbib_

PDB Entry: 6hbi (more details), 1.8 Å

PDB Description: scapharca dimeric hemoglobin, mutant t72v, deoxy form
PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d6hbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hbib_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d6hbib_:

Click to download the PDB-style file with coordinates for d6hbib_.
(The format of our PDB-style files is described here.)

Timeline for d6hbib_: