Lineage for d2q1ya2 (2q1y A:206-312)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420833Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1420864Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
    Uniprot O08378
  8. 1420869Domain d2q1ya2: 2q1y A:206-312 [150005]
    Other proteins in same PDB: d2q1ya1, d2q1yb1
    automatically matched to d1rlua2
    complexed with gsp

Details for d2q1ya2

PDB Entry: 2q1y (more details), 2.3 Å

PDB Description: crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with gtp-gamma-s
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2q1ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q1ya2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

SCOPe Domain Coordinates for d2q1ya2:

Click to download the PDB-style file with coordinates for d2q1ya2.
(The format of our PDB-style files is described here.)

Timeline for d2q1ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q1ya1