Lineage for d2q1ya1 (2q1y A:8-205)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1361115Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1361146Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
    Uniprot O08378
  8. 1361151Domain d2q1ya1: 2q1y A:8-205 [150004]
    Other proteins in same PDB: d2q1ya2, d2q1yb2
    automatically matched to d1rlua1
    complexed with gsp

Details for d2q1ya1

PDB Entry: 2q1y (more details), 2.3 Å

PDB Description: crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with gtp-gamma-s
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2q1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q1ya1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

SCOPe Domain Coordinates for d2q1ya1:

Click to download the PDB-style file with coordinates for d2q1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2q1ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q1ya2