![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (9 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries) Uniprot O08378 |
![]() | Domain d2q1xb1: 2q1x B:8-205 [150002] Other proteins in same PDB: d2q1xa2, d2q1xb2 automatically matched to d1rlua1 complexed with cit |
PDB Entry: 2q1x (more details), 2.35 Å
SCOPe Domain Sequences for d2q1xb1:
Sequence, based on SEQRES records: (download)
>d2q1xb1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl lngvqgitdlittpglin
>d2q1xb1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgdpevgrka aedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfegk rqaengiaalrescdtlivipndrllvslmdafrsadevllngvqgitdlittpglin
Timeline for d2q1xb1: